PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.28677s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family CPP
Protein Properties Length: 158aa    MW: 17541.9 Da    PI: 7.8079
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.28677s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.25.2e-1664103242
                   TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                           ++kgC+Ck+skClk+YC+Cfa+g+ C++ C C dC+N++e+
  Araha.28677s0001.1.p  64 KHKGCRCKQSKCLKLYCDCFASGVLCTD-CDCADCHNNSEN 103
                           789*************************.********9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.6E-1663103IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163416.2564157IPR005172CRC domain
PfamPF036388.2E-1366100IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 158 aa     Download sequence    Send to blast
MTGNADSGKI ATEKDPRKLV FTKLELSPVF LESPVKELPP FPPISRKHSE TKDTTDQEGI  60
TSRKHKGCRC KQSKCLKLYC DCFASGVLCT DCDCADCHNN SENCDARDAA VLNVLGRNPN  120
AFNEKLFSSI NDKQVCSSNL SLCETEERRV YIRKHLP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ6304951e-152AJ630495.1 Arabidopsis thaliana mRNA for hypothetical protein, clone At3g16160.
GenBankDQ6530891e-152DQ653089.1 Arabidopsis thaliana clone 0000013135_0000009456 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002885126.13e-82predicted protein
SwissprotQ700D08e-81TCX8_ARATH; Protein tesmin/TSO1-like CXC 8
TrEMBLD7L5L03e-82D7L5L0_ARALL; Predicted protein
STRINGAl_scaffold_0003_16831e-81(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM148441520
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16160.15e-82Tesmin/TSO1-like CXC domain-containing protein